PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2027_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 353aa    MW: 37350.2 Da    PI: 9.5128
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2027_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP139.87.4e-4495170176
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                    +CqvegC++dls+ak y++rhkvC++hsk+pvv+v+gleqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+
  Neem_2027_f_4  95 RCQVEGCKVDLSDAKAYYSRHKVCSMHSKSPVVIVAGLEQRFCQQCSRFHLLPEFDQGKRSCRRRLAGHNERRRKP 170
                    6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-3688157IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.69393170IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.19E-4194174IPR004333Transcription factor, SBP-box
PfamPF031105.5E-3396169IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MELGSGSFTT ESGESSTSLH GLKFGQKIYF EDVGSSSSSG GNNNNNNNII QVNNNPSGGS  60
ASGVSSSSGS GRKVRGGGGG AGGVVQTGGG GQPPRCQVEG CKVDLSDAKA YYSRHKVCSM  120
HSKSPVVIVA GLEQRFCQQC SRFHLLPEFD QGKRSCRRRL AGHNERRRKP PPGSVLANRH  180
GRLSSSVTEN GGRGGGFLVD FSAYQGVTVR DGWPVTRVSE QVPGNQTNII TRHVPHPQWH  240
YHSENPPTDR YLQCLTGGTS FSAPGIPSRE CFTGIVDSSC ALSLLSNQPW GSRSRAAGLG  300
VGDLMQAESK SMAQPVSPRG NQYPNMSWCF KGNEAATSTT TPAHSSGFLS GER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31961691184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006492888.11e-140PREDICTED: squamosa promoter-binding-like protein 9 isoform X1
RefseqXP_006492889.11e-140PREDICTED: squamosa promoter-binding-like protein 9 isoform X1
TrEMBLB8Y9B11e-141B8Y9B1_PONTR; Squamosa promoter-binding protein
STRINGVIT_08s0007g06270.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-61squamosa promoter binding protein-like 9